Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : B0X578
dbSWEET id: dbswt_1118
Accession: B0X578
Uniprot status: Unreviewed
Organism: Culex quinquefasciatus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Culicinae ⇒ Culicini ⇒ Culex ⇒ Culex.
Sequence Information back to top
Sequence length: 223
Substrate Binding Site: TNWN CVV: 457 CHI: -0.9
Selectivity Filter: QLLV CVV: 467 CHI: 8.3
Fasta sequence:
>tr|B0X578|B0X578_CULQU|Unreviewed|Culex_quinquefasciatus|223
MLDALSEVLQPYKELVGNAAAIVTVLQMFSGCFVCNDIRRKGSSSGFSPMPFIGGCALTV
LFLQHALLMGDPAMIKANVVGFGISAVYATFFLLYTPRNGRADFWKQVAMSTALTAALLA
YAQMENPAVVEDRFGLIVTILMLMLIAQPLFGLPEIMRKKSTEGLPFAMILSGTIVGFMW
LLYGVILNNMFVILQNLAGVTLSAIQLALFAIYPSKDSKKKKN
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 6 Model end: 215
Alignment file: B0X578.pir
Inward Open:
Template: 5CTG.pdb
Model structure: B0X578_inward.pdb
Procheck score ⇒ Ramachandran plot: 88.4% favored 9.9% allowed .6% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: B0X578_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.3% favored 7.2% allowed .6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: B0X578_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.7% favored 7.2% allowed 1.1% week .0% disallowed
Gene Informationback to top
Gene ID: 6047788 Total Exons: 4 Coding Exons: 4
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5