Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B0X578

dbSWEET id: dbswt_1118

Accession:   B0X578

Uniprot status:   Unreviewed

Organism:   Culex quinquefasciatus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Culicinae ⇒ Culicini ⇒ Culex ⇒ Culex.

Sequence Information back to top


Sequence length:   223

Substrate Binding Site:   TNWN           CVV:   457       CHI:   -0.9

Selectivity Filter:   QLLV           CVV:   467       CHI:   8.3

Fasta sequence:

>tr|B0X578|B0X578_CULQU|Unreviewed|Culex_quinquefasciatus|223
MLDALSEVLQPYKELVGNAAAIVTVLQMFSGCFVCNDIRRKGSSSGFSPMPFIGGCALTV
LFLQHALLMGDPAMIKANVVGFGISAVYATFFLLYTPRNGRADFWKQVAMSTALTAALLA
YAQMENPAVVEDRFGLIVTILMLMLIAQPLFGLPEIMRKKSTEGLPFAMILSGTIVGFMW
LLYGVILNNMFVILQNLAGVTLSAIQLALFAIYPSKDSKKKKN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   6     Model end:   215

Alignment file: B0X578.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  B0X578_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.4% favored    9.9% allowed    .6% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  B0X578_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    7.2% allowed    .6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  B0X578_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.7% favored    7.2% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Gene ID:   6047788     Total Exons:   4     Coding Exons:   4

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur