| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : B0WXK1
dbSWEET id: dbswt_1117
Accession: B0WXK1
Uniprot status: Unreviewed
Organism: Culex quinquefasciatus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Culicinae ⇒ Culicini ⇒ Culex ⇒ Culex.
Sequence Information back to top
Sequence length: 230
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: QFLV CVV: 478 CHI: 7.3
Fasta sequence:
>tr|B0WXK1|B0WXK1_CULQU|Unreviewed|Culex_quinquefasciatus|230
MEALAVTLEPYKDRIGMSAAIITVVQFFSGVFVINDIRKRGSTEGFSAGPFLGGSVFCLL
NIQFGQMLRDDAMIQVNFIGLALNIVYVCAFYLFTVGAAKTKVWGQIGVAGAVVAGILSY
VQYEDPQLVEFRFGVILTVILLLLVGMPLLGLGEILKKKCTEGLPFPIIFAGTLVSLSWL
LYGIVLRNDFIVVQNLIALALCSVQLALFAIFPSKPASKVTQKPTTKKTN
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 214
Alignment file: B0WXK1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: B0WXK1_inward.pdb
Procheck score ⇒ Ramachandran plot: 89.4% favored 8.3% allowed 2.2% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: B0WXK1_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.3% favored 5.0% allowed 1.7% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: B0WXK1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 87.8% favored 10.6% allowed .6% week 1.1% disallowed
Gene Informationback to top
Gene ID: 6044635 Total Exons: 3 Coding Exons: 3
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number



Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5