Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A9P051

dbSWEET id: dbswt_466

Accession:   A9P051

Uniprot status:   Unreviewed

Organism:   Picea sitchensis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Pinidae ⇒ Pinales ⇒ Pinaceae ⇒ Picea.

Sequence Information back to top


Sequence length:   228

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   VSMN           CVV:   398       CHI:   1.8

Fasta sequence:

>tr|A9P051|A9P051_PICSI|Unreviewed|Picea_sitchensis|228
MANVSFILGVIGNVISLLVFLSPAKTFWRIVRNNSTEDFHYLPYICTLLSTSLWTYYGLI
KPGGLLISTVNGAGAVLESVYVILFLIYCPKELKIKAAVLVVLVDIIAFTSVFLVTFLAL
DQQIRITVIGVLCVCLSLTMYGSPLAITRSVIVTKSVEFMPFFLSFFLFLNGGIWAAWAV
LKQDVFVGIPNGIGFGLGASQLILYLIYRKGKPKAEVTQNLLHTDMNA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   210

Alignment file: A9P051.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A9P051_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.0% favored    4.3% allowed    .5% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A9P051_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.9% favored    5.4% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A9P051_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.4% favored    7.1% allowed    .0% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur