Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A9NZG1

dbSWEET id: dbswt_523

Accession:   A9NZG1

Uniprot status:   Unreviewed

Organism:   Picea sitchensis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Pinidae ⇒ Pinales ⇒ Pinaceae ⇒ Picea.

Sequence Information back to top


Sequence length:   272

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNLN           CVV:   440       CHI:   0.6

Fasta sequence:

>tr|A9NZG1|A9NZG1_PICSI|Unreviewed|Picea_sitchensis|272
MEKDHIRLAVGIIGNITSLLLYGAPVLTFMKVIKEKSVGQYSCTPYLIALFNCLIYTWYG
FPVVSNGWENFLVSTVNGVGIVPECFAICTYIVYAPPKFKRKVARMVGCVLVLFGVMAAI
SFFSLHDHKNRKFMIGIVGILSSISLYSAPFVAMKLVIQTKSVEFMPFYLSFFAFINCIM
WMTYGALSRDIFLATPNVIGSPLALAQLVLYCIYRKKTRGVQNGNNLDPEEGVQINGAQS
TNSEEKTKLPDGQKGENAEYINTTEIKTILIN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   216

Alignment file: A9NZG1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A9NZG1_inward.pdb

Procheck score ⇒ Ramachandran plot: 87.3% favored    7.4% allowed    3.7% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A9NZG1_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    4.2% allowed    1.6% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A9NZG1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.5% favored    6.9% allowed    1.6% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur