| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A9BBY7
dbSWEET id: dbswt_1639
Accession: A9BBY7
Uniprot status: Unreviewed
Organism: Prochlorococcus marinus
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 115
Substrate Binding Site: ININ CVV: 440 CHI: 2
Selectivity Filter: AGAG CVV: 230 CHI: 2.8
Fasta sequence:
>tr|A9BBY7|A9BBY7_PROM4|Unreviewed|Prochlorococcus marinus| 115
MGSTHKIYLSSMSSLSPIDILGLVAGSLTTAAFVPQLLKVWISKSANDISYLMFILFIIG
IVLWEIYGWEIHSMPVILFNIITFILGLAILILKFVFDSRNNLKSKEKIINNTSN
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 19 Model end: 96 Inward Open: Template: 4X5M.pdb Model structure: A9BBY7_inward.pdb Alignment file: A9BBY7_inw.pir Procheck score ⇒ Ramachandran plot: 92.6% favored 5.9% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A9BBY7_outward.pdb Alignment file: A9BBY7_out.pir Procheck score ⇒ Ramachandran plot: 91.9% favored 7.4% allowed .7% week .0% disallowed Occluded: Model structure: A9BBY7_occluded.pdb Alignment file: A9BBY7_occ.pir Procheck score ⇒ Ramachandran plot: 97.1% favored 2.9% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA