| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A8XV96
dbSWEET id: dbswt_1116
Accession: A8XV96
Uniprot status: Unreviewed
Organism: Caenorhabditis briggsae
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.
Sequence Information back to top
Sequence length: 238
Substrate Binding Site: SQAN CVV: 350 CHI: -6
Selectivity Filter: LGSM CVV: 344 CHI: 4.9
Fasta sequence:
>tr|A8XV96|A8XV96_CAEBR|Unreviewed|Caenorhabditis_briggsae|238
MELDLGTVSASRLFAMYTSNLVWSLFLTSTALHAVALITSPVQAVYKWVRRQSSDSDTPI
PYICAVIGSALWLRYSVFLRDTKLILLQTYAVSMQLFFVVALIFYRTKRRKLIRLMTGIA
AAMSLLFLYIDNLNDEDGKEFTGRIASGAQIAGSLVCPYLIYKAITSKCIDFVPLAPVVF
TWVMELHAIVYSIGIDDFYMLLANVIFFCMDGSLLSMFFVYPTEKKKKNLKSPIPTVM
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 16 Model end: 223
Alignment file: A8XV96.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A8XV96_inward.pdb
Procheck score ⇒ Ramachandran plot: 89.5% favored 7.9% allowed 1.6% week 1.0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A8XV96_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 7.9% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A8XV96_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.5% favored 7.3% allowed 2.6% week .5% disallowed
Gene Informationback to top
Gene ID: 8579550 Total Exons: 7 Coding Exons: 7
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number







Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA