Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A8XRN1

dbSWEET id: dbswt_1115

Accession:   A8XRN1

Uniprot status:   Unreviewed

Organism:   Caenorhabditis briggsae

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.

Sequence Information back to top


Sequence length:   359

Substrate Binding Site:   GTWN           CVV:   400       CHI:   -5.5

Selectivity Filter:   LGDV           CVV:   368       CHI:   4.1

Fasta sequence:

>tr|A8XRN1|A8XRN1_CAEBR|Unreviewed|Caenorhabditis_briggsae|359
MFEIFTQGFSFLNLLSILAFFTTVGLFFCGIPICRQIWKRKDTKEISGAPFLMGVVGGCC
WMTYGWLKNDGTVKWVTGCQVILYTTYTIFYWCMTKKKLWITLKVLGVIGICTSLVLGVH
FFGMKIFHPLGIVCLTLNIADFAAPLGGIRVVIRRWATSTLPLPLCIANFLVSSEWFLYG
LLKNDFYLIFPNGVGSLLAFIQLLLFVVLPRKPGQRAPIVRLWLWIRGVKVEETKEIVAE
LGECDEKKMNRAQRWSQKIKMNVSTVAEELENVIYNLPTKDQFAYTHKIGDDDSSSEKTV
ETPEGSKKTSVVEAPKVSPVIEGVKDADFERKMRNSLRAAQEARETALRRTISSPDLSD

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   211

Alignment file: A8XRN1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A8XRN1_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.3% favored    8.5% allowed    .6% week    1.7% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A8XRN1_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    7.3% allowed    .0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A8XRN1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 88.7% favored    9.0% allowed    1.1% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur