Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A8XI14

dbSWEET id: dbswt_976

Accession:   A8XI14

Uniprot status:   Reviewed

Organism:   Caenorhabditis briggsae

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.

Sequence Information back to top


Sequence length:   293

Substrate Binding Site:   GNWN           CVV:   403       CHI:   -8.3

Selectivity Filter:   LGNV           CVV:   373       CHI:   4.1

Fasta sequence:

>sp|A8XI14|SWET1_CAEBR|Reviewed|Caenorhabditis_briggsae|293
MIEVVLQVLSISAITTTIALFFCGIPICMQIRRQGAVGDISGVPFLMGVLGGSFWLRYGL
LKMDYTMIIVNVVGVFCMAVYCIFFLIYSLPKKTFTCQLILVTSTITGMVVWIAFKPNLD
YLGIICMTFNIMNFGAPLAGLGVVLRNREVSTLPLPMCVANFLVSSQWCLYGNLVQDIYI
IIPNGIGMFLAIVQLSLFIVLPRRENEKSPLEQLANWFTGRDRNKKEKDLETGECAEPSS
PQKIPSDVHEKLEKLMAAEASSESRRCSADFMDHPPSYKSRSSSVPDIFSVQS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   203

Alignment file: A8XI14.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A8XI14_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    6.3% allowed    1.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A8XI14_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    5.1% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A8XI14_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    7.4% allowed    .6% week    .6% disallowed

Gene Informationback to top


Gene ID:   8576958     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0005794 - Golgi apparatus

GO:0000139 - Golgi membrane

GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur