| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A8XI14
dbSWEET id: dbswt_976
Accession: A8XI14
Uniprot status: Reviewed
Organism: Caenorhabditis briggsae
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.
Sequence Information back to top
Sequence length: 293
Substrate Binding Site: GNWN CVV: 403 CHI: -8.3
Selectivity Filter: LGNV CVV: 373 CHI: 4.1
Fasta sequence:
>sp|A8XI14|SWET1_CAEBR|Reviewed|Caenorhabditis_briggsae|293
MIEVVLQVLSISAITTTIALFFCGIPICMQIRRQGAVGDISGVPFLMGVLGGSFWLRYGL
LKMDYTMIIVNVVGVFCMAVYCIFFLIYSLPKKTFTCQLILVTSTITGMVVWIAFKPNLD
YLGIICMTFNIMNFGAPLAGLGVVLRNREVSTLPLPMCVANFLVSSQWCLYGNLVQDIYI
IIPNGIGMFLAIVQLSLFIVLPRRENEKSPLEQLANWFTGRDRNKKEKDLETGECAEPSS
PQKIPSDVHEKLEKLMAAEASSESRRCSADFMDHPPSYKSRSSSVPDIFSVQS
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 203
Alignment file: A8XI14.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A8XI14_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 6.3% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A8XI14_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 5.1% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A8XI14_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 7.4% allowed .6% week .6% disallowed
Gene Informationback to top
Gene ID: 8576958 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0005794 - Golgi apparatus
GO:0000139 - Golgi membrane
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA