Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A8HVE3

dbSWEET id: dbswt_765

Accession:   A8HVE3

Uniprot status:   Unreviewed

Organism:   Chlamydomonas reinhardtii

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Chlorophyta ⇒ Chlorophyceae ⇒ Chlamydomonadales ⇒ Chlamydomonadaceae ⇒ Chlamydomonas.

Sequence Information back to top


Sequence length:   231

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   MNYN           CVV:   457       CHI:   -6.4

Fasta sequence:

>tr|A8HVE3|A8HVE3_CHLRE|Unreviewed|Chlamydomonas_reinhardtii|231
MTAWTGRRALLDDDDEFDFKKLFLHHLAPGLGCIIAFLMFVSPLKTVLQIRANKHLGDLN
PLPLVAIIANCAAWLIYGCINADPYVITANEPGLLLGIFMTVSCYGFADPKARDVMLKAL
MFFAVLLSAVGIAIALFIEEDETASKTAGYTAVFILLCYYGAPLSTMAEVLRSRSSASLF
WPTSLMNTINGLLWVAYGTAVSDPFIAVPNAIGAAFGVIQIGLINIYPAKK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   18     Model end:   229

Alignment file: A8HVE3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A8HVE3_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.0% favored    3.3% allowed    2.2% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A8HVE3_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    7.7% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A8HVE3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    7.1% allowed    .5% week    .0% disallowed

Gene Informationback to top


Gene ID:   5721764     Total Exons:   7     Coding Exons:   7

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur