Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A8HVE3
dbSWEET id: dbswt_765
Accession: A8HVE3
Uniprot status: Unreviewed
Organism: Chlamydomonas reinhardtii
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Chlorophyta ⇒ Chlorophyceae ⇒ Chlamydomonadales ⇒ Chlamydomonadaceae ⇒ Chlamydomonas.
Sequence Information back to top
Sequence length: 231
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: MNYN CVV: 457 CHI: -6.4
Fasta sequence:
>tr|A8HVE3|A8HVE3_CHLRE|Unreviewed|Chlamydomonas_reinhardtii|231
MTAWTGRRALLDDDDEFDFKKLFLHHLAPGLGCIIAFLMFVSPLKTVLQIRANKHLGDLN
PLPLVAIIANCAAWLIYGCINADPYVITANEPGLLLGIFMTVSCYGFADPKARDVMLKAL
MFFAVLLSAVGIAIALFIEEDETASKTAGYTAVFILLCYYGAPLSTMAEVLRSRSSASLF
WPTSLMNTINGLLWVAYGTAVSDPFIAVPNAIGAAFGVIQIGLINIYPAKK
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 18 Model end: 229
Alignment file: A8HVE3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A8HVE3_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.0% favored 3.3% allowed 2.2% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A8HVE3_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.8% favored 7.7% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A8HVE3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.3% favored 7.1% allowed .5% week .0% disallowed
Gene Informationback to top
Gene ID: 5721764 Total Exons: 7 Coding Exons: 7
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA