| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A8AZ02
dbSWEET id: dbswt_1636
Accession: A8AZ02
Uniprot status: Unreviewed
Organism: Streptococcus gordonii
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|A8AZ02|A8AZ02_STRGC|Unreviewed|Streptococcus gordonii|87
MSKQKINRFVGSIGAFIGILVFIAYIPQIIANLQGEKAQPFQPLFAAVSCLIWVIYGWTK
EPKKDWILIIPNAAGVILGGLTFLTSL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: A8AZ02_inward.pdb Alignment file: A8AZ02_inw.pir Procheck score ⇒ Ramachandran plot: 91.3% favored 6.3% allowed 2.4% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A8AZ02_outward.pdb Alignment file: A8AZ02_out.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 9.5% allowed .0% week .8% disallowed Occluded: Model structure: A8AZ02_occluded.pdb Alignment file: A8AZ02_occ.pir Procheck score ⇒ Ramachandran plot: 90.5% favored 7.1% allowed 2.4% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA