| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A7SZC5
dbSWEET id: dbswt_1113
Accession: A7SZC5
Uniprot status: Unreviewed
Organism: Nematostella vectensis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Cnidaria ⇒ Anthozoa ⇒ Hexacorallia ⇒ Actiniaria ⇒ Edwardsiidae ⇒ Nematostella.
Sequence Information back to top
Sequence length: 216
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: FNMC CVV: 441 CHI: 3.7
Fasta sequence:
>tr|A7SZC5|A7SZC5_NEMVE|Unreviewed|Nematostella_vectensis|216
MLLEILSWLAIVLTIGFFASGILACKRIIVSGDVGDVQFLPFVTTLMNCLLWTIYGYLKD
DSTIIIVNFVGALLQVVYILCFLYFSRERGNNLAFLFYSAIASASLFMYLSFVIVESNTR
LSHMGKICIVVTIMMQASPLATVARVIRTKSTESMQFTFSFLITLCSFVWLCYGTVIYDI
NVQLPNLSGVLLGFSQLSLFCIYSSTPGSKVPVTIA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 205
Alignment file: A7SZC5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A7SZC5_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 4.3% allowed 1.6% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A7SZC5_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 6.4% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A7SZC5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.4% favored 9.6% allowed .5% week .5% disallowed
Gene Informationback to top
Gene ID: 5501773 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA