Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A7SZC5

dbSWEET id: dbswt_1113

Accession:   A7SZC5

Uniprot status:   Unreviewed

Organism:   Nematostella vectensis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Cnidaria ⇒ Anthozoa ⇒ Hexacorallia ⇒ Actiniaria ⇒ Edwardsiidae ⇒ Nematostella.

Sequence Information back to top


Sequence length:   216

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   FNMC           CVV:   441       CHI:   3.7

Fasta sequence:

>tr|A7SZC5|A7SZC5_NEMVE|Unreviewed|Nematostella_vectensis|216
MLLEILSWLAIVLTIGFFASGILACKRIIVSGDVGDVQFLPFVTTLMNCLLWTIYGYLKD
DSTIIIVNFVGALLQVVYILCFLYFSRERGNNLAFLFYSAIASASLFMYLSFVIVESNTR
LSHMGKICIVVTIMMQASPLATVARVIRTKSTESMQFTFSFLITLCSFVWLCYGTVIYDI
NVQLPNLSGVLLGFSQLSLFCIYSSTPGSKVPVTIA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   205

Alignment file: A7SZC5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A7SZC5_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    4.3% allowed    1.6% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A7SZC5_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    6.4% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A7SZC5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.4% favored    9.6% allowed    .5% week    .5% disallowed

Gene Informationback to top


Gene ID:   5501773     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur