| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A7SFC4
dbSWEET id: dbswt_1112
Accession: A7SFC4
Uniprot status: Unreviewed
Organism: Nematostella vectensis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Cnidaria ⇒ Anthozoa ⇒ Hexacorallia ⇒ Actiniaria ⇒ Edwardsiidae ⇒ Nematostella.
Sequence Information back to top
Sequence length: 225
Substrate Binding Site: SSWN CVV: 405 CHI: -6
Selectivity Filter: MSVV CVV: 407 CHI: 9.5
Fasta sequence:
>tr|A7SFC4|A7SFC4_NEMVE|Unreviewed|Nematostella_vectensis|225
MDAKALLSWTATISQFGMLLSGAQICLRIQRQGSTGDVAVLPFLATCASSILWTKYGLLT
KDFPITVISAAGIIFQSLYLLIFYLNSRDKKTLNPKLFWSFCLVCGVLSYIKYHVMDKET
AVFHLGLVCSVFSVAVYGSPLVSLATVIRKKSTECLTFSLCLANFLVSLQWAMYGKLAQD
NFITVPNSVGALLGSLQLSLFVCYPSTPQRTVTYTPGSKPSSWEV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 206
Alignment file: A7SFC4.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A7SFC4_inward.pdb
Procheck score ⇒ Ramachandran plot: 86.6% favored 12.4% allowed 1.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A7SFC4_outward.pdb
Procheck score ⇒ Ramachandran plot: 89.8% favored 8.6% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A7SFC4_occluded.pdb
Procheck score ⇒ Ramachandran plot: 88.7% favored 10.8% allowed .5% week .0% disallowed
Gene Informationback to top
Gene ID: 5509141 Total Exons: 7 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA