Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A5GFL6

dbSWEET id: dbswt_1632

Accession:   A5GFL6

Uniprot status:   Unreviewed

Organism:   Geobacter uraniireducens

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Deltaproteobacteria ⇒ Desulfuromonadales ⇒ Geobacteraceae ⇒ Geobacter.

Sequence Information back to top


Sequence length:   92

Substrate Binding Site:   MNMN           CVV:   440       CHI:   -3.2

Selectivity Filter:   AGAG           CVV:   230       CHI:   2.8

Fasta sequence:

>tr|A5GFL6|A5GFL6_GEOUR|Unreviewed|Geobacter uraniireducens|92
MNITHLGLLAGALTSAAAIPQVVRTYRTRQARDISIWQPVLLNIGMVLWLIYGLVIGDTP
LIVANIFSIVCYSFLIAMKILYKDDDKSTSCV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   81

Inward Open:

Template:   4X5M.pdb

Model structure:  A5GFL6_inward.pdb    Alignment file: A5GFL6_inw.pir

Procheck score ⇒ Ramachandran plot: 94.0% favored    4.5% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A5GFL6_outward.pdb    Alignment file: A5GFL6_out.pir

Procheck score ⇒ Ramachandran plot: 92.5% favored    7.5% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A5GFL6_occluded.pdb    Alignment file: A5GFL6_occ.pir

Procheck score ⇒ Ramachandran plot: 98.5% favored    1.5% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur