| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A5GFL6
dbSWEET id: dbswt_1632
Accession: A5GFL6
Uniprot status: Unreviewed
Organism: Geobacter uraniireducens
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Deltaproteobacteria ⇒ Desulfuromonadales ⇒ Geobacteraceae ⇒ Geobacter.
Sequence Information back to top
Sequence length: 92
Substrate Binding Site: MNMN CVV: 440 CHI: -3.2
Selectivity Filter: AGAG CVV: 230 CHI: 2.8
Fasta sequence:
>tr|A5GFL6|A5GFL6_GEOUR|Unreviewed|Geobacter uraniireducens|92
MNITHLGLLAGALTSAAAIPQVVRTYRTRQARDISIWQPVLLNIGMVLWLIYGLVIGDTP
LIVANIFSIVCYSFLIAMKILYKDDDKSTSCV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 4 Model end: 81 Inward Open: Template: 4X5M.pdb Model structure: A5GFL6_inward.pdb Alignment file: A5GFL6_inw.pir Procheck score ⇒ Ramachandran plot: 94.0% favored 4.5% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A5GFL6_outward.pdb Alignment file: A5GFL6_out.pir Procheck score ⇒ Ramachandran plot: 92.5% favored 7.5% allowed .0% week .0% disallowed Occluded: Model structure: A5GFL6_occluded.pdb Alignment file: A5GFL6_occ.pir Procheck score ⇒ Ramachandran plot: 98.5% favored 1.5% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA