| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A5BWR7
dbSWEET id: dbswt_756
Accession: A5BWR7
Uniprot status: Unreviewed
Organism: Vitis vinifera
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ Vitales ⇒ Vitaceae ⇒ Vitis.
Sequence Information back to top
Sequence length: 249
Substrate Binding Site: CSWN CVV: 418 CHI: -2.7
Selectivity Filter: LNMC CVV: 430 CHI: 4.7
Fasta sequence:
>tr|A5BWR7|A5BWR7_VITVI|Unreviewed|Vitis_vinifera|249
MDAHHALHFTFGIFGNATALFLFLAPLITFKRIIKSKSTEQFSGIPYVMTLLNCLLSAWY
GLPFVSKNNILDDPPSMALEQPLKIIYVLIFIAYSIKKERAKILGLFIFVLSVFGVVVFV
SLFALHGHGRKLFCGLAATIFSIIMYASPLSIMRMVIKTKSVEYMPFFLSLFVFLCGTSW
FVFGLLGKDPFVAVPNGFGCGLGAMQLILYAIYCKKGKSKNLAAADKPVDMELGKPQQEK
QSRAQNGNV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: A5BWR7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A5BWR7_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.5% favored 5.4% allowed 1.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A5BWR7_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 4.3% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A5BWR7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 5.9% allowed 1.1% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA