Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A5BWR7

dbSWEET id: dbswt_756

Accession:   A5BWR7

Uniprot status:   Unreviewed

Organism:   Vitis vinifera

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ Vitales ⇒ Vitaceae ⇒ Vitis.

Sequence Information back to top


Sequence length:   249

Substrate Binding Site:   CSWN           CVV:   418       CHI:   -2.7

Selectivity Filter:   LNMC           CVV:   430       CHI:   4.7

Fasta sequence:

>tr|A5BWR7|A5BWR7_VITVI|Unreviewed|Vitis_vinifera|249
MDAHHALHFTFGIFGNATALFLFLAPLITFKRIIKSKSTEQFSGIPYVMTLLNCLLSAWY
GLPFVSKNNILDDPPSMALEQPLKIIYVLIFIAYSIKKERAKILGLFIFVLSVFGVVVFV
SLFALHGHGRKLFCGLAATIFSIIMYASPLSIMRMVIKTKSVEYMPFFLSLFVFLCGTSW
FVFGLLGKDPFVAVPNGFGCGLGAMQLILYAIYCKKGKSKNLAAADKPVDMELGKPQQEK
QSRAQNGNV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   215

Alignment file: A5BWR7.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A5BWR7_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.5% favored    5.4% allowed    1.1% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A5BWR7_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.6% favored    4.3% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A5BWR7_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.5% favored    5.9% allowed    1.1% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur