Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A5BI99

dbSWEET id: dbswt_460

Accession:   A5BI99

Uniprot status:   Unreviewed

Organism:   Vitis vinifera

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ Vitales ⇒ Vitaceae ⇒ Vitis.

Sequence Information back to top


Sequence length:   298

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   VSMN           CVV:   398       CHI:   1.8

Fasta sequence:

>tr|A5BI99|A5BI99_VITVI|Unreviewed|Vitis_vinifera|298
MASLSFIIGIIGNVISILVFASPIGTFRRVVKKKSTENYKGIPYITTLLSTSLWSFYGIL
KPGGLLVLTVNGAGAIMQFIYVTLFLIYAPRDVKIKSMKVAAVLDVGFLGAVIALTLLAF
HGSSRLICVGIFCAGLTIVMYASPLSAMRMVIKTKSVEFMPFFLSFFLFLNGGVWSVYAV
LVTDFFIGVPNAVGFVLGSAQLILYAVYRNKSRPSATSEERVEEEGSAHTVKRAVEMQVS
KDDGKASPKNHSLSKGRSLPMPFISRQYSLQKIMRTLSWSPCELQDRQQDKDIEKGDI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   210

Alignment file: A5BI99.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A5BI99_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.6% favored    2.8% allowed    .6% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A5BI99_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.0% favored    3.3% allowed    1.1% week    .6% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A5BI99_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.4% favored    5.5% allowed    .6% week    .6% disallowed

Gene Informationback to top


Gene ID:   100257903     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur