| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A5AIV2
dbSWEET id: dbswt_183
Accession: A5AIV2
Uniprot status: Unreviewed
Organism: Vitis vinifera
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ Vitales ⇒ Vitaceae ⇒ Vitis.
Sequence Information back to top
Sequence length: 273
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A5AIV2|A5AIV2_VITVI|Unreviewed|Vitis_vinifera|273
MALFPIHHPLVFIFGILGNLISFMVYLAPLPTFYQIYKRKSTEGFQSVPYVVALFSAMLW
IYYAFLNTDASLLITINSVGCVIETSYIVMFLVYAPKKARITTVKLVFLMNICGFGSILL
LTLLLAEGANRVRILGWVCLVFSLSVFLAPLCIMRQVIRTKSVEYMPFLLSFFLTLSAVM
WFFYGLMLKDFYIAGPNILGFVFGIVQMVLYLIYRNRKKVLENEKLPELSEQIIDVVKLS
TMVCSEVNLTNQQHSNEGHGTTEKQGLEVIVAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 4 Model end: 216
Alignment file: A5AIV2.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A5AIV2_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 6.9% allowed 1.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A5AIV2_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 6.9% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A5AIV2_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 5.8% allowed .5% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22