Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A4RVT1

dbSWEET id: dbswt_766

Accession:   A4RVT1

Uniprot status:   Unreviewed

Organism:   Ostreococcus lucimarinus

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Chlorophyta ⇒ prasinophytes ⇒ Mamiellophyceae ⇒ Mamiellales ⇒ Bathycoccaceae ⇒ Ostreococcus.

Sequence Information back to top


Sequence length:   242

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   MNYN           CVV:   457       CHI:   -6.4

Fasta sequence:

>tr|A4RVT1|A4RVT1_OSTLU|Unreviewed|Ostreococcus_lucimarinus|242
MGDTRDALTLWFAPALGSALAQVMFLSPFPEIERCKTKRSLGHLNALPYPFVAANCAAWM
IYGGISGNYWVYIPNFTGYFCGTYYSFVAYALDEKIRGTMERIVAVLIILVSFIGMVVSC
VMKNSSESARLVVAGILANLILVVYYSAPLSTMAEVVRTKDSKSMHFPLVFCNGLNGLCW
TTYGIALNDWWIAAPNLFGSVLSIVQVVLIFLYPSSERLRSRITPTPSVEGLVSMSSDSS
PL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   3     Model end:   215

Alignment file: A4RVT1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A4RVT1_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    7.5% allowed    .5% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A4RVT1_outward.pdb

Procheck score ⇒ Ramachandran plot: 90.4% favored    8.6% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A4RVT1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    5.3% allowed    1.1% week    .5% disallowed

Gene Informationback to top


Gene ID:   5001631     Total Exons:   1     Coding Exons:   1

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur