Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A4RVT1
dbSWEET id: dbswt_766
Accession: A4RVT1
Uniprot status: Unreviewed
Organism: Ostreococcus lucimarinus
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Chlorophyta ⇒ prasinophytes ⇒ Mamiellophyceae ⇒ Mamiellales ⇒ Bathycoccaceae ⇒ Ostreococcus.
Sequence Information back to top
Sequence length: 242
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: MNYN CVV: 457 CHI: -6.4
Fasta sequence:
>tr|A4RVT1|A4RVT1_OSTLU|Unreviewed|Ostreococcus_lucimarinus|242
MGDTRDALTLWFAPALGSALAQVMFLSPFPEIERCKTKRSLGHLNALPYPFVAANCAAWM
IYGGISGNYWVYIPNFTGYFCGTYYSFVAYALDEKIRGTMERIVAVLIILVSFIGMVVSC
VMKNSSESARLVVAGILANLILVVYYSAPLSTMAEVVRTKDSKSMHFPLVFCNGLNGLCW
TTYGIALNDWWIAAPNLFGSVLSIVQVVLIFLYPSSERLRSRITPTPSVEGLVSMSSDSS
PL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 3 Model end: 215
Alignment file: A4RVT1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A4RVT1_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 7.5% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A4RVT1_outward.pdb
Procheck score ⇒ Ramachandran plot: 90.4% favored 8.6% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A4RVT1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 5.3% allowed 1.1% week .5% disallowed
Gene Informationback to top
Gene ID: 5001631 Total Exons: 1 Coding Exons: 1
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA