Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A3CLI6
dbSWEET id: dbswt_1630
Accession: A3CLI6
Uniprot status: Unreviewed
Organism: Streptococcus sanguinis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A3CLI6|A3CLI6_STRSV|Unreviewed|Streptococcus sanguinis|86
MKEKHMLILGWAATLMSVMMYVSYISQIMNNLAGNKGDFIQPSVAALNCTLWVIYGLFKD
KRDIPLAAANMPGIVFGLITAATALM
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: A3CLI6_inward.pdb Alignment file: A3CLI6_inw.pir Procheck score ⇒ Ramachandran plot: 90.9% favored 9.1% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A3CLI6_outward.pdb Alignment file: A3CLI6_out.pir Procheck score ⇒ Ramachandran plot: 94.7% favored 5.3% allowed .0% week .0% disallowed Occluded: Model structure: A3CLI6_occluded.pdb Alignment file: A3CLI6_occ.pir Procheck score ⇒ Ramachandran plot: 92.4% favored 7.6% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA