Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A2XGM7

dbSWEET id: dbswt_311

Accession:   A2XGM7

Uniprot status:   Reviewed

Organism:   Oryza sativa

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.

Sequence Information back to top


Sequence length:   300

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>sp|A2XGM7|SWT12_ORYSI|Reviewed|Oryza_sativa|300
MVQALVFAVGIVGNILSFLVILAPVPTFYRVYKKKSTESFQSVPYAVALLSAMLWLYYAL
LTSDLLLLSINSIGCLVESLYLTVYLLYAPRQAMAFTLKLVCAMNLALFAAVVAALQLLV
KATDRRVTLAGGIGASFALAVFVAPLTIIRQVIRTKSVEFMPFWLSFFLTLSAVVWFFYG
LLMKDFFVATPNVLGLLFGLAQMVLYVVYKDPKKNSAVSEAAAAQQVEVKDQQQLQMQLQ
ASPAVAPLDVDADADADLEAAAPATPQRPADDDAIDHRSVVVDIPPPPQPPPALPAVEVA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   211

Alignment file: A2XGM7.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A2XGM7_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.1% favored    6.8% allowed    1.0% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A2XGM7_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.3% favored    4.7% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A2XGM7_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.2% favored    6.2% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0005887 - integral component of plasma membrane

GO:0032588 - trans-Golgi network membrane

GO:0012506 - vesicle membrane

GO:0008515 - sucrose transmembrane transporter activity

GO:0051119 - sugar transmembrane transporter activity

GO:0071836 - nectar secretion

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur