Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0NDW1
dbSWEET id: dbswt_1111
Accession: A0NDW1
Uniprot status: Unreviewed
Organism: Anopheles gambiae
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Anophelinae ⇒ Anopheles.
Sequence Information back to top
Sequence length: 227
Substrate Binding Site: SSWK CVV: 444 CHI: -6.4
Selectivity Filter: QLFA CVV: 440 CHI: 4.9
Fasta sequence:
>tr|A0NDW1|A0NDW1_ANOGA|Unreviewed|Anopheles_gambiae|227
MFTTPLLAGLEAHRERIGQAAGLLTVAQYLAGWFICSDIRRRGTSAGVSPLRFIGGCGLS
ILQLQYSEKLQAPALIWTSIFTLAFSLLYSLWFWWYTPPSGRGALYRLTAAVATVTAGLY
AYGAQGDGPDVMYRLGMVLTVLALAFIALPLAQLRSIIRAKSSAGLPLPAILASTGATVL
WLLYGLLINNTFIVVQKIIAMGLCTVQLSLFIIYPASTSSGGEKKKQ
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 7 Model end: 216
Alignment file: A0NDW1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0NDW1_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.1% favored 6.7% allowed 1.7% week .6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0NDW1_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.3% favored 6.1% allowed .6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0NDW1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.3% favored 5.6% allowed 1.1% week .0% disallowed
Gene Informationback to top
Gene ID: 4577007 Total Exons: 4 Coding Exons: 4
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5