Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0NDW1

dbSWEET id: dbswt_1111

Accession:   A0NDW1

Uniprot status:   Unreviewed

Organism:   Anopheles gambiae

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Anophelinae ⇒ Anopheles.

Sequence Information back to top


Sequence length:   227

Substrate Binding Site:   SSWK           CVV:   444       CHI:   -6.4

Selectivity Filter:   QLFA           CVV:   440       CHI:   4.9

Fasta sequence:

>tr|A0NDW1|A0NDW1_ANOGA|Unreviewed|Anopheles_gambiae|227
MFTTPLLAGLEAHRERIGQAAGLLTVAQYLAGWFICSDIRRRGTSAGVSPLRFIGGCGLS
ILQLQYSEKLQAPALIWTSIFTLAFSLLYSLWFWWYTPPSGRGALYRLTAAVATVTAGLY
AYGAQGDGPDVMYRLGMVLTVLALAFIALPLAQLRSIIRAKSSAGLPLPAILASTGATVL
WLLYGLLINNTFIVVQKIIAMGLCTVQLSLFIIYPASTSSGGEKKKQ

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   7     Model end:   216

Alignment file: A0NDW1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0NDW1_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.1% favored    6.7% allowed    1.7% week    .6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0NDW1_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.3% favored    6.1% allowed    .6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0NDW1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.3% favored    5.6% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Gene ID:   4577007     Total Exons:   4     Coding Exons:   4

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur