| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A1W9MJ61
dbSWEET id: dbswt_2073
Accession: A0A1W9MJ61
Uniprot status: Unreviewed
Organism: Candidatus Altiarchaeales
Kingdom: Archaea
Sequence Information back to top
Sequence length: 95
Substrate Binding Site: MNMN CVV: 440 CHI: -3.2
Selectivity Filter: GGGG CVV: 192 CHI: -1.6
Fasta sequence:
>tr|A0A1W9MJ61|A0A1W9MJ61_9EURY|Unreviewed|Candidatus Altiarchaeales|95
MDSISMLGITAGAIVLAGFIPQIYKGWKTKRLDDLSYFMMGLLSSGMFLWIIYGFFRNDI
VIILANAVGILLNLILIAMKFHYGKISRTKFHQGL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: A0A1W9MJ61_inward.pdb Alignment file: A0A1W9MJ61_inw.pir Procheck score ⇒ Ramachandran plot: 96.2% favored 2.3% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A1W9MJ61_outward.pdb Alignment file: A0A1W9MJ61_out.pir Procheck score ⇒ Ramachandran plot: 95.5% favored 4.5% allowed .0% week .0% disallowed Occluded: Model structure: A0A1W9MJ61_occluded.pdb Alignment file: A0A1W9MJ61_occ.pir Procheck score ⇒ Ramachandran plot: 97.7% favored 2.3% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA