Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A1V5AJV0
dbSWEET id: dbswt_2070
Accession: A0A1V5AJV0
Uniprot status: Unreviewed
Organism: Methanoregulaceae archaeon
Kingdom: Archaea
Taxonomy back to top
Archaea ⇒ Euryarchaeota ⇒ Methanomicrobia ⇒ Methanomicrobiales;Methanoregulaceae.
Sequence Information back to top
Sequence length: 94
Substrate Binding Site: VNVN CVV: 402 CHI: 1.4
Selectivity Filter: GGGG CVV: 192 CHI: -1.6
Fasta sequence:
>tr|A0A1V5AJV0|A0A1V5AJV0_9EURY|Unreviewed|Methanoregulaceae archaeon|94
MDVWLLIGGLAALLTTFGFLPQILKMYRTRSVKDISPITFVQFLVGVGLWAFYGMHIGDS
IVTAANIVTFGTLVVALGLYVHFGGYLMKSPQSA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: A0A1V5AJV0_inward.pdb Alignment file: A0A1V5AJV0_inw.pir Procheck score ⇒ Ramachandran plot: 96.1% favored 3.9% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A1V5AJV0_outward.pdb Alignment file: A0A1V5AJV0_out.pir Procheck score ⇒ Ramachandran plot: 94.5% favored 5.5% allowed .0% week .0% disallowed Occluded: Model structure: A0A1V5AJV0_occluded.pdb Alignment file: A0A1V5AJV0_occ.pir Procheck score ⇒ Ramachandran plot: 97.7% favored 2.3% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA