Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A1V4Z845

dbSWEET id: dbswt_2069

Accession:   A0A1V4Z845

Uniprot status:   Unreviewed

Organism:   Methanocella

Kingdom:   Archaea

Taxonomy back to top


Archaea ⇒ Euryarchaeota ⇒ Methanomicrobia ⇒ Methanocellales;Methanocellaceae ⇒ Methanocella.

Sequence Information back to top


Sequence length:   94

Substrate Binding Site:   SNSN           CVV:   338       CHI:   -8.6

Selectivity Filter:   AGAG           CVV:   230       CHI:   2.8

Fasta sequence:

>tr|A0A1V4Z845|A0A1V4Z845_9EURY|Unreviewed|Methanocella|94
MIPYPEIGIFGSLLLAGAFLPQCYRLLNTKSAKDISFFYPAVLSVGSFCLTVYGYGIHDV
IVFTLNLYATFCNTELMLLKVYYDRKNRKAAVVQ

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A1V4Z845_inward.pdb    Alignment file: A0A1V4Z845_inw.pir

Procheck score ⇒ Ramachandran plot: 93.3% favored    6.0% allowed    .7% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A1V4Z845_outward.pdb    Alignment file: A0A1V4Z845_out.pir

Procheck score ⇒ Ramachandran plot: 94.0% favored    4.5% allowed    1.5% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A1V4Z845_occluded.pdb    Alignment file: A0A1V4Z845_occ.pir

Procheck score ⇒ Ramachandran plot: 95.5% favored    4.5% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur