| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A1V4Z845
dbSWEET id: dbswt_2069
Accession: A0A1V4Z845
Uniprot status: Unreviewed
Organism: Methanocella
Kingdom: Archaea
Taxonomy back to top
Archaea ⇒ Euryarchaeota ⇒ Methanomicrobia ⇒ Methanocellales;Methanocellaceae ⇒ Methanocella.
Sequence Information back to top
Sequence length: 94
Substrate Binding Site: SNSN CVV: 338 CHI: -8.6
Selectivity Filter: AGAG CVV: 230 CHI: 2.8
Fasta sequence:
>tr|A0A1V4Z845|A0A1V4Z845_9EURY|Unreviewed|Methanocella|94
MIPYPEIGIFGSLLLAGAFLPQCYRLLNTKSAKDISFFYPAVLSVGSFCLTVYGYGIHDV
IVFTLNLYATFCNTELMLLKVYYDRKNRKAAVVQ
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: A0A1V4Z845_inward.pdb Alignment file: A0A1V4Z845_inw.pir Procheck score ⇒ Ramachandran plot: 93.3% favored 6.0% allowed .7% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A1V4Z845_outward.pdb Alignment file: A0A1V4Z845_out.pir Procheck score ⇒ Ramachandran plot: 94.0% favored 4.5% allowed 1.5% week .0% disallowed Occluded: Model structure: A0A1V4Z845_occluded.pdb Alignment file: A0A1V4Z845_occ.pir Procheck score ⇒ Ramachandran plot: 95.5% favored 4.5% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA