Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A1V4UED2

dbSWEET id: dbswt_2067

Accession:   A0A1V4UED2

Uniprot status:   Unreviewed

Organism:   Methanoregulaceae archaeon

Kingdom:   Archaea

Taxonomy back to top


Archaea ⇒ Euryarchaeota ⇒ Methanomicrobia ⇒ Methanomicrobiales;Methanoregulaceae.

Sequence Information back to top


Sequence length:   94

Substrate Binding Site:   VNVN           CVV:   402       CHI:   1.4

Selectivity Filter:   GGGG           CVV:   192       CHI:   -1.6

Fasta sequence:

>tr|A0A1V4UED2|A0A1V4UED2_9EURY|Unreviewed|Methanoregulaceae archaeon|94
MDVWLLIGGLAALLTTFGFLPQILKMYRTRSVKDISPITFVQFLVGVGLWAFYGMHIGDS
IVTAANIITFGTLVVALGLYVHFGGYLMKSPQSA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A1V4UED2_inward.pdb    Alignment file: A0A1V4UED2_inw.pir

Procheck score ⇒ Ramachandran plot: 95.3% favored    4.7% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A1V4UED2_outward.pdb    Alignment file: A0A1V4UED2_out.pir

Procheck score ⇒ Ramachandran plot: 93.8% favored    5.5% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A1V4UED2_occluded.pdb    Alignment file: A0A1V4UED2_occ.pir

Procheck score ⇒ Ramachandran plot: 98.4% favored    1.6% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur