| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A1S6H0J9
dbSWEET id: dbswt_2065
Accession: A0A1S6H0J9
Uniprot status: Unreviewed
Organism: uncultured archaeon
Kingdom: Archaea
Sequence Information back to top
Sequence length: 114
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: AAAA CVV: 268 CHI: 7.2
Fasta sequence:
>tr|A0A1S6H0J9|A0A1S6H0J9_9ARCH|Unreviewed|uncultured archaeon|114
MAQSKSLLKLCKQGVNEMTILSILATIFGTIGGLANLPQWIKIFRRKSAKDISIITYSFV
FIAAIIWLLYGIEINNFPLILANVFGVINLGLVIIGWLIYGREKIKNNSKRRKV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 22 Model end: 99 Inward Open: Template: 4X5M.pdb Model structure: A0A1S6H0J9_inward.pdb Alignment file: A0A1S6H0J9_inw.pir Procheck score ⇒ Ramachandran plot: 92.4% favored 7.6% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A1S6H0J9_outward.pdb Alignment file: A0A1S6H0J9_out.pir Procheck score ⇒ Ramachandran plot: 93.2% favored 5.3% allowed .8% week .8% disallowed Occluded: Model structure: A0A1S6H0J9_occluded.pdb Alignment file: A0A1S6H0J9_occ.pir Procheck score ⇒ Ramachandran plot: 97.0% favored 3.0% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA