Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A1S6H0J9

dbSWEET id: dbswt_2065

Accession:   A0A1S6H0J9

Uniprot status:   Unreviewed

Organism:   uncultured archaeon

Kingdom:   Archaea

Taxonomy back to top


Archaea ⇒ environmental samples.

Sequence Information back to top


Sequence length:   114

Substrate Binding Site:   ANAN           CVV:   326       CHI:   -3.4

Selectivity Filter:   AAAA           CVV:   268       CHI:   7.2

Fasta sequence:

>tr|A0A1S6H0J9|A0A1S6H0J9_9ARCH|Unreviewed|uncultured archaeon|114
MAQSKSLLKLCKQGVNEMTILSILATIFGTIGGLANLPQWIKIFRRKSAKDISIITYSFV
FIAAIIWLLYGIEINNFPLILANVFGVINLGLVIIGWLIYGREKIKNNSKRRKV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   22     Model end:   99

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A1S6H0J9_inward.pdb    Alignment file: A0A1S6H0J9_inw.pir

Procheck score ⇒ Ramachandran plot: 92.4% favored    7.6% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A1S6H0J9_outward.pdb    Alignment file: A0A1S6H0J9_out.pir

Procheck score ⇒ Ramachandran plot: 93.2% favored    5.3% allowed    .8% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A1S6H0J9_occluded.pdb    Alignment file: A0A1S6H0J9_occ.pir

Procheck score ⇒ Ramachandran plot: 97.0% favored    3.0% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur