Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A1J5U8Z3
dbSWEET id: dbswt_2064
Accession: A0A1J5U8Z3
Uniprot status: Unreviewed
Organism: Marine Group
Kingdom: Archaea
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: LNLN CVV: 440 CHI: 0.6
Selectivity Filter: GSGS CVV: 242 CHI: -2.4
Fasta sequence:
>tr|A0A1J5U8Z3|A0A1J5U8Z3_9EURY|Unreviewed|Marine Group|86
MDWVEGIGLFAGFLGVSGWYPQLKRVWIDGRADGISVPTFVVICISLTLWLIYGVLKNSI
AIIVANVLALLMIGSVAIGAYRIQNQ
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: A0A1J5U8Z3_inward.pdb Alignment file: A0A1J5U8Z3_inw.pir Procheck score ⇒ Ramachandran plot: 93.7% favored 4.8% allowed .0% week 1.6% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A1J5U8Z3_outward.pdb Alignment file: A0A1J5U8Z3_out.pir Procheck score ⇒ Ramachandran plot: 93.7% favored 5.6% allowed .8% week .0% disallowed Occluded: Model structure: A0A1J5U8Z3_occluded.pdb Alignment file: A0A1J5U8Z3_occ.pir Procheck score ⇒ Ramachandran plot: 95.2% favored 4.8% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA