Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A1J5U8Z3

dbSWEET id: dbswt_2064

Accession:   A0A1J5U8Z3

Uniprot status:   Unreviewed

Organism:   Marine Group

Kingdom:   Archaea

Taxonomy back to top


Archaea ⇒ Euryarchaeota ⇒ Marine Group III.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   LNLN           CVV:   440       CHI:   0.6

Selectivity Filter:   GSGS           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|A0A1J5U8Z3|A0A1J5U8Z3_9EURY|Unreviewed|Marine Group|86
MDWVEGIGLFAGFLGVSGWYPQLKRVWIDGRADGISVPTFVVICISLTLWLIYGVLKNSI
AIIVANVLALLMIGSVAIGAYRIQNQ

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A1J5U8Z3_inward.pdb    Alignment file: A0A1J5U8Z3_inw.pir

Procheck score ⇒ Ramachandran plot: 93.7% favored    4.8% allowed    .0% week    1.6% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A1J5U8Z3_outward.pdb    Alignment file: A0A1J5U8Z3_out.pir

Procheck score ⇒ Ramachandran plot: 93.7% favored    5.6% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A1J5U8Z3_occluded.pdb    Alignment file: A0A1J5U8Z3_occ.pir

Procheck score ⇒ Ramachandran plot: 95.2% favored    4.8% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur