Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A1J4W264
dbSWEET id: dbswt_2063
Accession: A0A1J4W264
Uniprot status: Unreviewed
Organism: Candidatus Pacearchaeota
Kingdom: Archaea
Sequence Information back to top
Sequence length: 118
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: MSMS CVV: 394 CHI: 2.2
Fasta sequence:
>tr|A0A1J4W264|A0A1J4W264_9ARCH|Unreviewed|Candidatus Pacearchaeota|118
MVTQGYGMHHFHKRKRIHLKKEEFPSKNKKVRFLDGLIYVVSVIGPLMTLPQIFKIWVLK
NAEGVSFISWGTYTISAAIWLWYGIVHKDKPIIIANILWIIIHLMVVIGILVYGKNLL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 35 Model end: 112 Inward Open: Template: 4X5M.pdb Model structure: A0A1J4W264_inward.pdb Alignment file: A0A1J4W264_inw.pir Procheck score ⇒ Ramachandran plot: 95.5% favored 4.5% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A1J4W264_outward.pdb Alignment file: A0A1J4W264_out.pir Procheck score ⇒ Ramachandran plot: 93.9% favored 5.3% allowed .8% week .0% disallowed Occluded: Model structure: A0A1J4W264_occluded.pdb Alignment file: A0A1J4W264_occ.pir Procheck score ⇒ Ramachandran plot: 94.7% favored 4.5% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA