Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A1F9ZXX4

dbSWEET id: dbswt_2062

Accession:   A0A1F9ZXX4

Uniprot status:   Unreviewed

Organism:   Euryarchaeota archaeon

Kingdom:   Archaea

Taxonomy back to top


Archaea ⇒ Euryarchaeota.

Sequence Information back to top


Sequence length:   90

Substrate Binding Site:   MNMN           CVV:   440       CHI:   -3.2

Selectivity Filter:   GGGG           CVV:   192       CHI:   -1.6

Fasta sequence:

>tr|A0A1F9ZXX4|A0A1F9ZXX4_9EURY|Unreviewed|Euryarchaeota archaeon|90
MDAWTYLAFLAGALTSTGYVPQIIKGLGTRKMDDVSLLMPAVLGLGMFLWLLYGLAREDP
AIIVANIVGASLTTVLVAMKLYYRSSRAAI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A1F9ZXX4_inward.pdb    Alignment file: A0A1F9ZXX4_inw.pir

Procheck score ⇒ Ramachandran plot: 95.3% favored    3.1% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A1F9ZXX4_outward.pdb    Alignment file: A0A1F9ZXX4_out.pir

Procheck score ⇒ Ramachandran plot: 94.5% favored    4.7% allowed    .0% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A1F9ZXX4_occluded.pdb    Alignment file: A0A1F9ZXX4_occ.pir

Procheck score ⇒ Ramachandran plot: 94.5% favored    4.7% allowed    .0% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur