Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A1F9YMR5
dbSWEET id: dbswt_2060
Accession: A0A1F9YMR5
Uniprot status: Unreviewed
Organism: Euryarchaeota archaeon
Kingdom: Archaea
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: MNMN CVV: 440 CHI: -3.2
Selectivity Filter: GGGG CVV: 192 CHI: -1.6
Fasta sequence:
>tr|A0A1F9YMR5|A0A1F9YMR5_9EURY|Unreviewed|Euryarchaeota archaeon|86
MNLDTVEIIGLMAGIITSMGFLPQLFRGFKTKKLDDVSYFMPTVLSIGMSIWFLYGYLTK
SFAIIIANTFGIVCCIELIVMKKIYS
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 7 Model end: 84 Inward Open: Template: 4X5M.pdb Model structure: A0A1F9YMR5_inward.pdb Alignment file: A0A1F9YMR5_inw.pir Procheck score ⇒ Ramachandran plot: 90.9% favored 7.6% allowed .8% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A1F9YMR5_outward.pdb Alignment file: A0A1F9YMR5_out.pir Procheck score ⇒ Ramachandran plot: 91.7% favored 6.8% allowed 1.5% week .0% disallowed Occluded: Model structure: A0A1F9YMR5_occluded.pdb Alignment file: A0A1F9YMR5_occ.pir Procheck score ⇒ Ramachandran plot: 95.5% favored 4.5% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA