| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A1D2RAY7
dbSWEET id: dbswt_2058
Accession: A0A1D2RAY7
Uniprot status: Unreviewed
Organism: Candidatus Altiarchaeales
Kingdom: Archaea
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: LNLN CVV: 440 CHI: 0.6
Selectivity Filter: GGGG CVV: 192 CHI: -1.6
Fasta sequence:
>tr|A0A1D2RAY7|A0A1D2RAY7_9EURY|Unreviewed|Candidatus Altiarchaeales|88
MDWNILGLLAGAITASGFLPQIYRGYKTKSLEDLSYFMLIFFGVGLSLWLLYGIHLNDVP
IILANTAGVMCTITLILMKFKYSKNKKA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 4 Model end: 81 Inward Open: Template: 4X5M.pdb Model structure: A0A1D2RAY7_inward.pdb Alignment file: A0A1D2RAY7_inw.pir Procheck score ⇒ Ramachandran plot: 92.3% favored 6.9% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A1D2RAY7_outward.pdb Alignment file: A0A1D2RAY7_out.pir Procheck score ⇒ Ramachandran plot: 93.1% favored 6.2% allowed .8% week .0% disallowed Occluded: Model structure: A0A1D2RAY7_occluded.pdb Alignment file: A0A1D2RAY7_occ.pir Procheck score ⇒ Ramachandran plot: 94.6% favored 5.4% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA