Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A1D2RAY7

dbSWEET id: dbswt_2058

Accession:   A0A1D2RAY7

Uniprot status:   Unreviewed

Organism:   Candidatus Altiarchaeales

Kingdom:   Archaea

Taxonomy back to top


Archaea ⇒ Euryarchaeota ⇒ Candidatus Altiarchaeales.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   LNLN           CVV:   440       CHI:   0.6

Selectivity Filter:   GGGG           CVV:   192       CHI:   -1.6

Fasta sequence:

>tr|A0A1D2RAY7|A0A1D2RAY7_9EURY|Unreviewed|Candidatus Altiarchaeales|88
MDWNILGLLAGAITASGFLPQIYRGYKTKSLEDLSYFMLIFFGVGLSLWLLYGIHLNDVP
IILANTAGVMCTITLILMKFKYSKNKKA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   81

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A1D2RAY7_inward.pdb    Alignment file: A0A1D2RAY7_inw.pir

Procheck score ⇒ Ramachandran plot: 92.3% favored    6.9% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A1D2RAY7_outward.pdb    Alignment file: A0A1D2RAY7_out.pir

Procheck score ⇒ Ramachandran plot: 93.1% favored    6.2% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A1D2RAY7_occluded.pdb    Alignment file: A0A1D2RAY7_occ.pir

Procheck score ⇒ Ramachandran plot: 94.6% favored    5.4% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur