Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A1C7C520

dbSWEET id: dbswt_1627

Accession:   A0A1C7C520

Uniprot status:   Unreviewed

Organism:   Streptococcus salivarius

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|A0A1C7C520|A0A1C7C520_STRSL|Unreviewed|Streptococcus salivarius|87
MTKQKINRIVGSIGAFIGIVVFIAYIPQIIANLEGNKAQPFQPLSAAISCLIWVIYGWTK
EPKKDWVLIIPNSAGVILGGLTFLTSL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A1C7C520_inward.pdb    Alignment file: A0A1C7C520_inw.pir

Procheck score ⇒ Ramachandran plot: 88.9% favored    8.7% allowed    1.6% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A1C7C520_outward.pdb    Alignment file: A0A1C7C520_out.pir

Procheck score ⇒ Ramachandran plot: 96.8% favored    2.4% allowed    .0% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A1C7C520_occluded.pdb    Alignment file: A0A1C7C520_occ.pir

Procheck score ⇒ Ramachandran plot: 91.3% favored    7.1% allowed    .8% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur