Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A1C4CD87
dbSWEET id: dbswt_1626
Accession: A0A1C4CD87
Uniprot status: Unreviewed
Organism: Gilliamella
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Orbales ⇒ Orbaceae ⇒ Gilliamella.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A1C4CD87|A0A1C4CD87_9GAMM|Unreviewed|Gilliamella|87
MHLSPKAFRILGIIATIASLGMYVSYIPQIIDNLHGFKSNPTQPLAASINCTLWVCYGLL
REKKDWPIAIANSPGVFFGLIAFFTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 12 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: A0A1C4CD87_inward.pdb Alignment file: A0A1C4CD87_inw.pir Procheck score ⇒ Ramachandran plot: 93.0% favored 6.2% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A1C4CD87_outward.pdb Alignment file: A0A1C4CD87_out.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 7.8% allowed .0% week 1.6% disallowed Occluded: Model structure: A0A1C4CD87_occluded.pdb Alignment file: A0A1C4CD87_occ.pir Procheck score ⇒ Ramachandran plot: 92.2% favored 7.0% allowed .0% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA