Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A1C3ZM33
dbSWEET id: dbswt_1624
Accession: A0A1C3ZM33
Uniprot status: Unreviewed
Organism: Gilliamella
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Orbales ⇒ Orbaceae ⇒ Gilliamella.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A1C3ZM33|A0A1C3ZM33_9GAMM|Unreviewed|Gilliamella|87
MHLSPKAFRILGIIATIASLGMYVSYIPQIIDNLHGLKSNPTQPLAAAVNCALWVSYGLL
REKKDWPLAIANCPGVFFGLIAFLTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 12 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: A0A1C3ZM33_inward.pdb Alignment file: A0A1C3ZM33_inw.pir Procheck score ⇒ Ramachandran plot: 89.8% favored 9.4% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A1C3ZM33_outward.pdb Alignment file: A0A1C3ZM33_out.pir Procheck score ⇒ Ramachandran plot: 94.5% favored 3.9% allowed .0% week 1.6% disallowed Occluded: Model structure: A0A1C3ZM33_occluded.pdb Alignment file: A0A1C3ZM33_occ.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 4.7% allowed 1.6% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA