Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A1C3SWX5

dbSWEET id: dbswt_1623

Accession:   A0A1C3SWX5

Uniprot status:   Unreviewed

Organism:   Lactococcus piscium

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Lactococcus.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|A0A1C3SWX5|A0A1C3SWX5_9LACT|Unreviewed|Lactococcus piscium|86
MKNKVHLFIGSVGATIGLFVFLAYIPQIISNLNGDKSQPWQPLIAAISCLVWVLYGLTNQ
PKRDYILIIPNSLGVILGTLTFLTSL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A1C3SWX5_inward.pdb    Alignment file: A0A1C3SWX5_inw.pir

Procheck score ⇒ Ramachandran plot: 87.5% favored    10.9% allowed    .0% week    1.6% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A1C3SWX5_outward.pdb    Alignment file: A0A1C3SWX5_out.pir

Procheck score ⇒ Ramachandran plot: 95.3% favored    3.9% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A1C3SWX5_occluded.pdb    Alignment file: A0A1C3SWX5_occ.pir

Procheck score ⇒ Ramachandran plot: 94.5% favored    4.7% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur