Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A1C3SUE0

dbSWEET id: dbswt_1622

Accession:   A0A1C3SUE0

Uniprot status:   Unreviewed

Organism:   Lactococcus piscium

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Lactococcus.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A1C3SUE0|A0A1C3SUE0_9LACT|Unreviewed|Lactococcus piscium|86
MKQEKMIKYLSWVATGMSIMMYVSYIPQIADNLAGAKGNPIQPFVAAINCLLWVIYGLGK
KPRDLALATANFPGIIFGLIAFVTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A1C3SUE0_inward.pdb    Alignment file: A0A1C3SUE0_inw.pir

Procheck score ⇒ Ramachandran plot: 94.4% favored    5.6% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A1C3SUE0_outward.pdb    Alignment file: A0A1C3SUE0_out.pir

Procheck score ⇒ Ramachandran plot: 96.0% favored    3.2% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A1C3SUE0_occluded.pdb    Alignment file: A0A1C3SUE0_occ.pir

Procheck score ⇒ Ramachandran plot: 94.4% favored    4.8% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur