| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A1C3HNS3
dbSWEET id: dbswt_1621
Accession: A0A1C3HNS3
Uniprot status: Unreviewed
Organism: Cardiobacterium hominis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Cardiobacteriales ⇒ Cardiobacteriaceae ⇒ Cardiobacterium.
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A1C3HNS3|A0A1C3HNS3_9GAMM|Unreviewed|Cardiobacterium hominis|85
MHDKHIRILAIVATIAAICMYTSYIFQIQENLAGHKASPIQPLCAAINCTLWVVYGLFKT
PRDLPVAIANAPGIVLGIITCITSF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: A0A1C3HNS3_inward.pdb Alignment file: A0A1C3HNS3_inw.pir Procheck score ⇒ Ramachandran plot: 95.4% favored 3.8% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A1C3HNS3_outward.pdb Alignment file: A0A1C3HNS3_out.pir Procheck score ⇒ Ramachandran plot: 94.6% favored 3.8% allowed 1.5% week .0% disallowed Occluded: Model structure: A0A1C3HNS3_occluded.pdb Alignment file: A0A1C3HNS3_occ.pir Procheck score ⇒ Ramachandran plot: 96.9% favored 2.3% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA