Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A1C2A8H4

dbSWEET id: dbswt_1620

Accession:   A0A1C2A8H4

Uniprot status:   Unreviewed

Organism:   Elizabethkingia anophelis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Elizabethkingia.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|A0A1C2A8H4|A0A1C2A8H4_9FLAO|Unreviewed|Elizabethkingia anophelis|86
MKNKLNTIIGSIGAAIGIFVFLAYIPQIIANLEGIKGQPWQPLIAAISCFTWVIYGWTSQ
PKRDYILIIPNIFGVILGTMTFVTSL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A1C2A8H4_inward.pdb    Alignment file: A0A1C2A8H4_inw.pir

Procheck score ⇒ Ramachandran plot: 92.9% favored    7.1% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A1C2A8H4_outward.pdb    Alignment file: A0A1C2A8H4_out.pir

Procheck score ⇒ Ramachandran plot: 91.3% favored    6.3% allowed    1.6% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A1C2A8H4_occluded.pdb    Alignment file: A0A1C2A8H4_occ.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    5.6% allowed    1.6% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur