| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A1C2A8H4
dbSWEET id: dbswt_1620
Accession: A0A1C2A8H4
Uniprot status: Unreviewed
Organism: Elizabethkingia anophelis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Elizabethkingia.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|A0A1C2A8H4|A0A1C2A8H4_9FLAO|Unreviewed|Elizabethkingia anophelis|86
MKNKLNTIIGSIGAAIGIFVFLAYIPQIIANLEGIKGQPWQPLIAAISCFTWVIYGWTSQ
PKRDYILIIPNIFGVILGTMTFVTSL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: A0A1C2A8H4_inward.pdb Alignment file: A0A1C2A8H4_inw.pir Procheck score ⇒ Ramachandran plot: 92.9% favored 7.1% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A1C2A8H4_outward.pdb Alignment file: A0A1C2A8H4_out.pir Procheck score ⇒ Ramachandran plot: 91.3% favored 6.3% allowed 1.6% week .8% disallowed Occluded: Model structure: A0A1C2A8H4_occluded.pdb Alignment file: A0A1C2A8H4_occ.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 5.6% allowed 1.6% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA