Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A1B8H4N9
dbSWEET id: dbswt_1616
Accession: A0A1B8H4N9
Uniprot status: Unreviewed
Organism: Morganella psychrotolerans
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Enterobacterales ⇒ Morganellaceae ⇒ Morganella.
Sequence Information back to top
Sequence length: 92
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A1B8H4N9|A0A1B8H4N9_9GAMM|Unreviewed|Morganella psychrotolerans|92
MSGSESKPDGHSRFIRYLGWIATFTAFCMYVSYIPQIIDNLDGHKTSPLQPLAAAFNCTL
WVIYGIKVKDLPVAIANAPGVLFGLVAALTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 19 Model end: 93 Inward Open: Template: 4X5M.pdb Model structure: A0A1B8H4N9_inward.pdb Alignment file: A0A1B8H4N9_inw.pir Procheck score ⇒ Ramachandran plot: 94.4% favored 3.2% allowed 2.4% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A1B8H4N9_outward.pdb Alignment file: A0A1B8H4N9_out.pir Procheck score ⇒ Ramachandran plot: 93.7% favored 5.6% allowed .8% week .0% disallowed Occluded: Model structure: A0A1B8H4N9_occluded.pdb Alignment file: A0A1B8H4N9_occ.pir Procheck score ⇒ Ramachandran plot: 92.9% favored 5.6% allowed 1.6% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA