Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A1B8H222

dbSWEET id: dbswt_1615

Accession:   A0A1B8H222

Uniprot status:   Unreviewed

Organism:   Morganella psychrotolerans

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Enterobacterales ⇒ Morganellaceae ⇒ Morganella.

Sequence Information back to top


Sequence length:   92

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A1B8H222|A0A1B8H222_9GAMM|Unreviewed|Morganella psychrotolerans|92
MSDSESKPNGHSRFIRYLGWIATFTAFCMYVSYIPQIIDNLDGHKTSPLQPLAAAFNCTL
WVIYGIKVKDLPVAIANAPGVLFGLVAALTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   19     Model end:   93

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A1B8H222_inward.pdb    Alignment file: A0A1B8H222_inw.pir

Procheck score ⇒ Ramachandran plot: 92.9% favored    4.8% allowed    2.4% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A1B8H222_outward.pdb    Alignment file: A0A1B8H222_out.pir

Procheck score ⇒ Ramachandran plot: 93.7% favored    5.6% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A1B8H222_occluded.pdb    Alignment file: A0A1B8H222_occ.pir

Procheck score ⇒ Ramachandran plot: 92.9% favored    5.6% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur