Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A1B7IF51

dbSWEET id: dbswt_1612

Accession:   A0A1B7IF51

Uniprot status:   Unreviewed

Organism:   Buttiauxella ferragutiae

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Enterobacterales ⇒ Enterobacteriaceae ⇒ Buttiauxella.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   VNVN           CVV:   402       CHI:   1.4

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|A0A1B7IF51|A0A1B7IF51_9ENTR|Unreviewed|Buttiauxella ferragutiae|87
MSDFAWLGGVAACCTTGSFALQVIHILKNRDTKAISLSMYLVFVFGVLCWLLYGLTSGDM
PLMIANGITLLLAATVLTMKVMNERAK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A1B7IF51_inward.pdb    Alignment file: A0A1B7IF51_inw.pir

Procheck score ⇒ Ramachandran plot: 95.5% favored    3.0% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A1B7IF51_outward.pdb    Alignment file: A0A1B7IF51_out.pir

Procheck score ⇒ Ramachandran plot: 94.8% favored    3.7% allowed    .0% week    1.5% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A1B7IF51_occluded.pdb    Alignment file: A0A1B7IF51_occ.pir

Procheck score ⇒ Ramachandran plot: 96.3% favored    3.7% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur