Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A1B7I3U4
dbSWEET id: dbswt_1611
Accession: A0A1B7I3U4
Uniprot status: Unreviewed
Organism: Buttiauxella gaviniae
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Enterobacterales ⇒ Enterobacteriaceae ⇒ Buttiauxella.
Sequence Information back to top
Sequence length: 97
Substrate Binding Site: VNVN CVV: 402 CHI: 1.4
Selectivity Filter: SGSG CVV: 242 CHI: -2.4
Fasta sequence:
>tr|A0A1B7I3U4|A0A1B7I3U4_9ENTR|Unreviewed|Buttiauxella gaviniae|97
MTDFAWLGSVAACCTTGSFALQVLHILKNRDTKAISLSMYLVFVFGVLCWLLYGLSNNDM
PLMIANGITLVLAATVLVMKVMNERGIKTVSKKASLR
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: A0A1B7I3U4_inward.pdb Alignment file: A0A1B7I3U4_inw.pir Procheck score ⇒ Ramachandran plot: 96.4% favored 2.2% allowed 1.4% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A1B7I3U4_outward.pdb Alignment file: A0A1B7I3U4_out.pir Procheck score ⇒ Ramachandran plot: 95.7% favored 2.9% allowed .0% week 1.4% disallowed Occluded: Model structure: A0A1B7I3U4_occluded.pdb Alignment file: A0A1B7I3U4_occ.pir Procheck score ⇒ Ramachandran plot: 94.9% favored 5.1% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA