| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A1B6VZG7
dbSWEET id: dbswt_1610
Accession: A0A1B6VZG7
Uniprot status: Unreviewed
Organism: Eikenella
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Neisseriales ⇒ Neisseriaceae ⇒ Eikenella.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|A0A1B6VZG7|A0A1B6VZG7_9NEIS|Unreviewed|Eikenella|88
MISKKKFNTFIGSIGAAIGIFVFIAYIPQIIANLDGAKAQPWQPLFAAVSCLIWVLYGWS
KEPKKDWILIVPNAVGVILSSLTFLTAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 12 Model end: 89 Inward Open: Template: 4X5M.pdb Model structure: A0A1B6VZG7_inward.pdb Alignment file: A0A1B6VZG7_inw.pir Procheck score ⇒ Ramachandran plot: 91.5% favored 7.7% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A1B6VZG7_outward.pdb Alignment file: A0A1B6VZG7_out.pir Procheck score ⇒ Ramachandran plot: 92.3% favored 7.7% allowed .0% week .0% disallowed Occluded: Model structure: A0A1B6VZG7_occluded.pdb Alignment file: A0A1B6VZG7_occ.pir Procheck score ⇒ Ramachandran plot: 94.6% favored 3.1% allowed 2.3% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA