Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A1B3PWF5

dbSWEET id: dbswt_1608

Accession:   A0A1B3PWF5

Uniprot status:   Unreviewed

Organism:   Lactobacillus johnsonii

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   79

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A1B3PWF5|A0A1B3PWF5_LACJH|Unreviewed|Lactobacillus johnsonii|79
MIGRIGSVLSVLMYVSYIPQIMNNLQGNYGNPIQPLVAAINCFIWVLYALLREKKDWPLF
VANFPGILFGLATFITSLH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   79

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A1B3PWF5_inward.pdb    Alignment file: A0A1B3PWF5_inw.pir

Procheck score ⇒ Ramachandran plot: 88.9% favored    9.5% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A1B3PWF5_outward.pdb    Alignment file: A0A1B3PWF5_out.pir

Procheck score ⇒ Ramachandran plot: 90.5% favored    7.1% allowed    1.6% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A1B3PWF5_occluded.pdb    Alignment file: A0A1B3PWF5_occ.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    6.3% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur