Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A1B3PWF5
dbSWEET id: dbswt_1608
Accession: A0A1B3PWF5
Uniprot status: Unreviewed
Organism: Lactobacillus johnsonii
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 79
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A1B3PWF5|A0A1B3PWF5_LACJH|Unreviewed|Lactobacillus johnsonii|79
MIGRIGSVLSVLMYVSYIPQIMNNLQGNYGNPIQPLVAAINCFIWVLYALLREKKDWPLF
VANFPGILFGLATFITSLH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 4 Model end: 79 Inward Open: Template: 4X5M.pdb Model structure: A0A1B3PWF5_inward.pdb Alignment file: A0A1B3PWF5_inw.pir Procheck score ⇒ Ramachandran plot: 88.9% favored 9.5% allowed 1.6% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A1B3PWF5_outward.pdb Alignment file: A0A1B3PWF5_out.pir Procheck score ⇒ Ramachandran plot: 90.5% favored 7.1% allowed 1.6% week .8% disallowed Occluded: Model structure: A0A1B3PWF5_occluded.pdb Alignment file: A0A1B3PWF5_occ.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 6.3% allowed 1.6% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA