Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A1B1NT02

dbSWEET id: dbswt_1606

Accession:   A0A1B1NT02

Uniprot status:   Unreviewed

Organism:   Vibrio scophthalmi

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Vibrionales ⇒ Vibrionaceae ⇒ Vibrio.

Sequence Information back to top


Sequence length:   97

Substrate Binding Site:   ANAN           CVV:   326       CHI:   -3.4

Selectivity Filter:   AIAI           CVV:   382       CHI:   12.6

Fasta sequence:

>tr|A0A1B1NT02|A0A1B1NT02_9VIBR|Unreviewed|Vibrio scophthalmi|97
MALIERIGKALEPLMLVMGLISPLATMPQLYKLYVSHSEHALGLSLTTWLLYSFIALLWT
IYGIYHKNPTIWVGNCLGFLMYVAMVAGIIAHTGGTY

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   12     Model end:   91

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A1B1NT02_inward.pdb    Alignment file: A0A1B1NT02_inw.pir

Procheck score ⇒ Ramachandran plot: 95.5% favored    4.5% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A1B1NT02_outward.pdb    Alignment file: A0A1B1NT02_out.pir

Procheck score ⇒ Ramachandran plot: 91.8% favored    7.5% allowed    .7% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A1B1NT02_occluded.pdb    Alignment file: A0A1B1NT02_occ.pir

Procheck score ⇒ Ramachandran plot: 91.0% favored    8.2% allowed    .7% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur