Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A1A9RZT7
dbSWEET id: dbswt_1601
Accession: A0A1A9RZT7
Uniprot status: Unreviewed
Organism: Eikenella
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Neisseriales ⇒ Neisseriaceae ⇒ Eikenella.
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ANAN CVV: 326 CHI: -3.4
Fasta sequence:
>tr|A0A1A9RZT7|A0A1A9RZT7_9NEIS|Unreviewed|Eikenella|85
MNEKQIRILAVVATVMAVGMYVAYIPQIANNLAGHKGSPIQPLVAAVNCTLWVLYGLFKK
PRDLPVALANAPGIVFGLVAFVTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: A0A1A9RZT7_inward.pdb Alignment file: A0A1A9RZT7_inw.pir Procheck score ⇒ Ramachandran plot: 92.7% favored 7.3% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A1A9RZT7_outward.pdb Alignment file: A0A1A9RZT7_out.pir Procheck score ⇒ Ramachandran plot: 95.2% favored 4.0% allowed .8% week .0% disallowed Occluded: Model structure: A0A1A9RZT7_occluded.pdb Alignment file: A0A1A9RZT7_occ.pir Procheck score ⇒ Ramachandran plot: 95.2% favored 4.8% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA