| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A1A9RMZ0
dbSWEET id: dbswt_1599
Accession: A0A1A9RMZ0
Uniprot status: Unreviewed
Organism: Eikenella corrodens
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Neisseriales ⇒ Neisseriaceae ⇒ Eikenella.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|A0A1A9RMZ0|A0A1A9RMZ0_EIKCO|Unreviewed|Eikenella corrodens|88
MISKKKFNAFIGSIGAAIGIFVFIAYIPQIIANLEGEKAQPWQPLFAAVSCLIWVLYGWS
KEPKKDWILIVPNAVGVILGSLTFLTAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 12 Model end: 89 Inward Open: Template: 4X5M.pdb Model structure: A0A1A9RMZ0_inward.pdb Alignment file: A0A1A9RMZ0_inw.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 7.0% allowed 1.6% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A1A9RMZ0_outward.pdb Alignment file: A0A1A9RMZ0_out.pir Procheck score ⇒ Ramachandran plot: 91.4% favored 7.8% allowed .8% week .0% disallowed Occluded: Model structure: A0A1A9RMZ0_occluded.pdb Alignment file: A0A1A9RMZ0_occ.pir Procheck score ⇒ Ramachandran plot: 88.3% favored 10.2% allowed .8% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA