Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A1A9RIN6

dbSWEET id: dbswt_1598

Accession:   A0A1A9RIN6

Uniprot status:   Unreviewed

Organism:   Eikenella corrodens

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Neisseriales ⇒ Neisseriaceae ⇒ Eikenella.

Sequence Information back to top


Sequence length:   85

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ANAN           CVV:   326       CHI:   -3.4

Fasta sequence:

>tr|A0A1A9RIN6|A0A1A9RIN6_EIKCO|Unreviewed|Eikenella corrodens|85
MNEKQIRILAVVATVMAVGMYVAYIPQIANNLAGHKGSPIQPLVAAVNCTLWVLYGLFKK
PRDLPVSLANAPGIVFGLVAFITAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A1A9RIN6_inward.pdb    Alignment file: A0A1A9RIN6_inw.pir

Procheck score ⇒ Ramachandran plot: 92.7% favored    6.5% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A1A9RIN6_outward.pdb    Alignment file: A0A1A9RIN6_out.pir

Procheck score ⇒ Ramachandran plot: 96.0% favored    4.0% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A1A9RIN6_occluded.pdb    Alignment file: A0A1A9RIN6_occ.pir

Procheck score ⇒ Ramachandran plot: 95.2% favored    4.8% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur