Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A1A9HWB2

dbSWEET id: dbswt_1596

Accession:   A0A1A9HWB2

Uniprot status:   Unreviewed

Organism:   Niabella

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Chitinophagia ⇒ Chitinophagales ⇒ Chitinophagaceae ⇒ Niabella.

Sequence Information back to top


Sequence length:   90

Substrate Binding Site:   ENEN           CVV:   410       CHI:   -14

Selectivity Filter:   TNTN           CVV:   378       CHI:   -8.4

Fasta sequence:

>tr|A0A1A9HWB2|A0A1A9HWB2_9BACT|Unreviewed|Niabella|90
MNGVDLLGAVAGAITTLTFLPQVIKTIKDKSVKDISLMMFIIAAVNEAMWIVYGALKSDW
VIILTNAVILCLSLTMIYLKLAYTHKKTQP

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A1A9HWB2_inward.pdb    Alignment file: A0A1A9HWB2_inw.pir

Procheck score ⇒ Ramachandran plot: 95.1% favored    4.2% allowed    .7% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A1A9HWB2_outward.pdb    Alignment file: A0A1A9HWB2_out.pir

Procheck score ⇒ Ramachandran plot: 90.8% favored    9.2% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A1A9HWB2_occluded.pdb    Alignment file: A0A1A9HWB2_occ.pir

Procheck score ⇒ Ramachandran plot: 97.2% favored    2.8% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur