| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A199QM17
dbSWEET id: dbswt_1593
Accession: A0A199QM17
Uniprot status: Unreviewed
Organism: Lactobacillus plantarum
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 106
Substrate Binding Site: GNGN CVV: 288 CHI: -7.8
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A199QM17|A0A199QM17_LACPN|Unreviewed|Lactobacillus plantarum| 106
MKYKVDNGAYPSGKDAIDPKRVKYLKLISKLATFTCIAMYVSYIPQIISNFSGDPVSPLQ
PLVAMINGILWTGYGWFKTYKDWPVIISNVPGVIFGFITVLTVYIH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 29 Model end: 104 Inward Open: Template: 4X5M.pdb Model structure: A0A199QM17_inward.pdb Alignment file: A0A199QM17_inw.pir Procheck score ⇒ Ramachandran plot: 90.2% favored 9.0% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A199QM17_outward.pdb Alignment file: A0A199QM17_out.pir Procheck score ⇒ Ramachandran plot: 86.9% favored 8.2% allowed 3.3% week 1.6% disallowed Occluded: Model structure: A0A199QM17_occluded.pdb Alignment file: A0A199QM17_occ.pir Procheck score ⇒ Ramachandran plot: 85.2% favored 13.1% allowed .8% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA