Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A198G3N7

dbSWEET id: dbswt_1592

Accession:   A0A198G3N7

Uniprot status:   Unreviewed

Organism:   Cosenzaea myxofaciens

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Enterobacterales ⇒ Morganellaceae ⇒ Cosenzaea.

Sequence Information back to top


Sequence length:   130

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A198G3N7|A0A198G3N7_9GAMM|Unreviewed|Cosenzaea myxofaciens| 130
MQNEIDSENLNLIEITGKNTSTTILSSISQPLSLLFKTLNNKIAKLNEINIVTLVSWVAT
ITACGMYISYIPQIMDNLNGIKTSPFQPFVAAINCFLWTYYGVKSKEYPVAIANAPGILF
GSFACLSAII

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   56     Model end:   130

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A198G3N7_inward.pdb    Alignment file: A0A198G3N7_inw.pir

Procheck score ⇒ Ramachandran plot: 91.9% favored    5.6% allowed    2.4% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A198G3N7_outward.pdb    Alignment file: A0A198G3N7_out.pir

Procheck score ⇒ Ramachandran plot: 91.1% favored    6.5% allowed    2.4% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A198G3N7_occluded.pdb    Alignment file: A0A198G3N7_occ.pir

Procheck score ⇒ Ramachandran plot: 93.5% favored    4.0% allowed    1.6% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur